pennsylvaniamagiciansreviewed.com

Find out what technologies pennsylvaniamagiciansreviewed.com is using
Widgets

Google Fonts API

Google Fonts API

Download List of All Websites using Google Fonts API

   Making the web more beautiful, fast, and open through great typography.this website is using Open+Sans%3A300%2C300italic%2Cregular%2Citalic%2C600%2C600italic%2C700%2C700italic%2C800%2C800italic&subset=latin%2Clatin-ext&ver=GENERATE_VERSION font family

Tags:


Google Fonts API

Google Fonts API

Download List of All Websites using Google Fonts API

   Making the web more beautiful, fast, and open through great typography.this website is using Open+Sans:400italic,700italic,400,700&subset=latin,latin-ext font family

Tags:




Email Hosting Providers

SPF

SPF

Download List of All Websites using SPF

   The Sender Policy Framework (SPF) is an email-authentication technique which is used to prevent spammers from sending messages on behalf of your domain. With SPF an organisation can publish authorized mail servers.

Tags:




Operating Systems and Servers

Nginx 1.14.1

Nginx 1.14.1

Download List of All Websites using Nginx 1.14.1

   Nginx is a web server which can also be used as a reverse proxy, load balancer, mail proxy and HTTP cache. The software was created by Igor Sysoev and first publicly released in 2004. A company of the same name was founded in 2011 to provide support and Nginx plus paid software.

Tags:




Content Management System

WordPress 4.4.1

WordPress 4.4.1

Download List of All Websites using WordPress 4.4.1

   WordPress is a content management system based on PHP and MySQL that is usually used with the MySQL or MariaDB database servers but can also use the SQLite database engine.




Document Encoding

Character Encoding :UTF-8

Character Encoding :UTF-8

Download List of All Websites using Character Encoding :UTF-8

   This website is using UTF-8 character encoding in HTML , character encoding is used to represent a repertoire of characters by some kind of encoding system.


Chunked transfer encoding

Chunked transfer encoding

Download List of All Websites using Chunked transfer encoding

   Chunked transfer encoding is a streaming data transfer mechanism available in version 1.1 of the Hypertext Transfer Protocol (HTTP). In chunked transfer encoding, the data stream is divided into a series of non-overlapping "chunks"




Document Standards

Meta Description

Meta Description

Download List of All Websites using Meta Description

   A meta description is a 160-character snippet, a meta tag in HTML, that summarizes a page`s content. this website is having meta description of the following : Don't Stress Out. We've Got The Best Rated Performer In The Area Who Is Available For Hire. Kids and Adult Events. Read Reviews Now!


XFN 1.1

XFN 1.1

Download List of All Websites using XFN 1.1

   XFN is a technical term that is an acronym that stands for “XHTML Friends Network.” This is primarily used by websites that want to create a series of referral links between other websites in order to boost SEO ratings.

Tags:


Vary Header check for cookies

Vary Header check for cookies

Download List of All Websites using Vary Header check for cookies

   The Vary HTTP response header determines how to match future request headers to decide whether a cached response can be used rather than requesting a fresh one from the origin server. It is used by the server to indicate which headers it used when selecting a representation of a resource in a content negotiation algorithm.




Language

English United State - Language

English United State - Language

Download List of All Websites using English United State - Language

   this website is using English as a language parameter


English - Language

English - Language

Download List of All Websites using English - Language

   this website is using English as a language parameter




Mobile

Viewport  - Width

Viewport - Width

Download List of All Websites using Viewport - Width

   The viewport is the user`s visible area of a web page. The viewport varies with the device, and will be smaller on a mobile phone than on a computer screen. Before tablets and mobile phones, web pages were designed only for computer screens, and it was common for web pages to have a static design and a fixed size.

Tags:


Viewport  - initial-scale

Viewport - initial-scale

Download List of All Websites using Viewport - initial-scale

   The viewport is the user`s visible area of a web page. The viewport varies with the device, and will be smaller on a mobile phone than on a computer screen. Before tablets and mobile phones, web pages were designed only for computer screens, and it was common for web pages to have a static design and a fixed size.

Tags:




Widgets

Google Fonts API

Google Fonts API (removed)

2019-05-30 / 2019-05-30

|

Google Fonts API

Google Fonts API (removed)

2019-05-30 / 2019-05-30

|



Email Hosting Providers

SPF

SPF (removed)

2019-05-30 / 2019-05-30

|



Operating Systems and Servers

Nginx 1.14.1

Nginx 1.14.1 (removed)

2019-05-30 / 2019-05-30

|



Content Management System

WordPress 4.4.1

WordPress 4.4.1 (removed)

2019-05-30 / 2019-05-30

|



Document Encoding

Character Encoding :UTF-8

Character Encoding :UTF-8 (removed)

2019-05-30 / 2019-05-30

|

Chunked transfer encoding

Chunked transfer encoding (removed)

2019-05-30 / 2019-05-30

|



Document Standards

Meta Description

Meta Description (removed)

2019-05-30 / 2019-05-30

|

XFN 1.1

XFN 1.1 (removed)

2019-05-30 / 2019-05-30

|

Vary Header check for cookies

Vary Header check for cookies (removed)

2019-05-30 / 2019-05-30

|



Language

English United State - Language

English United State - Language (removed)

2019-05-30 / 2019-05-30

|

English - Language

English - Language (removed)

2019-05-30 / 2019-05-30

|



Mobile

Viewport  - Width

Viewport - Width (removed)

2019-05-30 / 2019-05-30

|

Viewport  - initial-scale

Viewport - initial-scale (removed)

2019-05-30 / 2019-05-30

|



Profile Details

Last technolgie detected on 2021-08-22 We know of 14 technologies on pennsylvaniamagiciansreviewed.com and 14 technologies detected on pennsylvaniamagiciansreviewed.com since 2019-05-30.




Download our browser extension from here.


Notify me when technology changes on pennsylvaniamagiciansreviewed.com


Suggest technology

Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.